Lineage for d3c1cf1 (3c1c F:224-302)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1082620Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1082621Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 1082622Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1082927Protein Histone H4 [47125] (7 species)
  7. 1082928Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (45 PDB entries)
  8. 1083004Domain d3c1cf1: 3c1c F:224-302 [155862]
    Other proteins in same PDB: d3c1cc1, d3c1cd1, d3c1cg1, d3c1ch1
    automatically matched to d1p3ob_
    protein/DNA complex

Details for d3c1cf1

PDB Entry: 3c1c (more details), 3.15 Å

PDB Description: The effect of H3 K79 dimethylation and H4 K20 trimethylation on nucleosome and chromatin structure
PDB Compounds: (F:) histone h4

SCOPe Domain Sequences for d3c1cf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c1cf1 a.22.1.1 (F:224-302) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
mdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d3c1cf1:

Click to download the PDB-style file with coordinates for d3c1cf1.
(The format of our PDB-style files is described here.)

Timeline for d3c1cf1: