SCOP 1.75: Domain d3c1cf1: 3c1c F:224-302

Lineage for d3c1cf1 (3c1c F:224-302)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H4 [47125] (5 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (33 PDB entries)

8. Domain d3c1cf1: 3c1c F:224-302 [155862]
   Other proteins in same PDB: d3c1cc1, d3c1cd1, d3c1cg1, d3c1ch1
   automatically matched to d1p3ob_
   complexed with m2l

Details for d3c1cf1

PDB Entry: 3c1c, 3.15 Å

PDB Description: The effect of H3 K79 dimethylation and H4 K20 trimethylation on nucleosome and chromatin structure

PDB Compounds: (F:) histone h4

SCOP Domain Sequences for d3c1cf1:

Sequence; same for both SEQRES and ATOM records:

>d3c1cf1 a.22.1.1 (F:224-302) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta
mdvvyalkrqgrtlygfgg

Timeline for d3c1cf1:

• d3c1cf1 is new in SCOP 1.75
  
• d3c1cf1 appears in SCOPe 2.01
  
• d3c1cf1 appears in the current release, SCOPe 2.08