Lineage for d3c1cd1 (3c1c D:1230-1322)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1082620Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1082621Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 1082622Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1082716Protein Histone H2B [47119] (6 species)
  7. 1082810Species Xenopus (Silurana) tropicalis [TaxId:8364] [158385] (2 PDB entries)
  8. 1082813Domain d3c1cd1: 3c1c D:1230-1322 [155861]
    Other proteins in same PDB: d3c1cb1, d3c1cc1, d3c1cf1, d3c1cg1
    automatically matched to d1s32d_
    protein/DNA complex

Details for d3c1cd1

PDB Entry: 3c1c (more details), 3.15 Å

PDB Description: The effect of H3 K79 dimethylation and H4 K20 trimethylation on nucleosome and chromatin structure
PDB Compounds: (D:) Histone 2, H2bf

SCOPe Domain Sequences for d3c1cd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c1cd1 a.22.1.1 (D:1230-1322) Histone H2B {Xenopus (Silurana) tropicalis [TaxId: 8364]}
rkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstitsr
eiqtavrlllpgelakhavsegtkavtkytsak

SCOPe Domain Coordinates for d3c1cd1:

Click to download the PDB-style file with coordinates for d3c1cd1.
(The format of our PDB-style files is described here.)

Timeline for d3c1cd1: