![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H2B [47119] (6 species) |
![]() | Species Xenopus (Silurana) tropicalis [TaxId:8364] [158385] (2 PDB entries) |
![]() | Domain d3c1cd1: 3c1c D:1230-1322 [155861] Other proteins in same PDB: d3c1cb1, d3c1cc1, d3c1cf1, d3c1cg1 automatically matched to d1s32d_ protein/DNA complex |
PDB Entry: 3c1c (more details), 3.15 Å
SCOPe Domain Sequences for d3c1cd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c1cd1 a.22.1.1 (D:1230-1322) Histone H2B {Xenopus (Silurana) tropicalis [TaxId: 8364]} rkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstitsr eiqtavrlllpgelakhavsegtkavtkytsak
Timeline for d3c1cd1: