| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H2B [47119] (6 species) |
| Species Xenopus (Silurana) tropicalis [TaxId:8364] [158385] (2 PDB entries) |
| Domain d3c1bh_: 3c1b H: [155858] Other proteins in same PDB: d3c1ba_, d3c1bb_, d3c1bc_, d3c1be_, d3c1bf_, d3c1bg_ automated match to d1kx5d_ protein/DNA complex |
PDB Entry: 3c1b (more details), 2.2 Å
SCOPe Domain Sequences for d3c1bh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c1bh_ a.22.1.1 (H:) Histone H2B {Xenopus (Silurana) tropicalis [TaxId: 8364]}
ktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstit
sreiqtavrlllpgelakhavsegtkavtkytsa
Timeline for d3c1bh_: