SCOPe 2.02: Domain d3c1ba_: 3c1b A:

Lineage for d3c1ba_ (3c1b A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H3 [47122] (6 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (39 PDB entries)

8. Domain d3c1ba_: 3c1b A: [155851]
   Other proteins in same PDB: d3c1bb_, d3c1bc_, d3c1bd_, d3c1bf_, d3c1bg_, d3c1bh_
   automated match to d1kx5a_
   protein/DNA complex

Details for d3c1ba_

PDB Entry: 3c1b, 2.2 Å

PDB Description: The effect of H3 K79 dimethylation and H4 K20 trimethylation on nucleosome and chromatin structure

PDB Compounds: (A:) Histone H3-like

SCOPe Domain Sequences for d3c1ba_:

Sequence; same for both SEQRES and ATOM records:

>d3c1ba_ a.22.1.1 (A:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
aylvalfedtnlcaihakrvtimpkdiqlarrirgera

Timeline for d3c1ba_:

• d3c1ba_ first appeared in SCOP 1.75, called d3c1ba1
  
• d3c1ba_ appears in SCOPe 2.01
  
• d3c1ba_ appears in SCOPe 2.03
  
• d3c1ba_ appears in the current release, SCOPe 2.08