SCOP 1.75: Domain d3c1bh1: 3c1b H:1428-1521

Lineage for d3c1bh1 (3c1b H:1428-1521)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2B [47119] (6 species)

7. Species Xenopus (Silurana) tropicalis [TaxId:8364] [158385] (2 PDB entries)

8. Domain d3c1bh1: 3c1b H:1428-1521 [155858]
   Other proteins in same PDB: d3c1ba1, d3c1bb1, d3c1bc1, d3c1be1, d3c1bf1, d3c1bg1
   automatically matched to d1s32d_
   complexed with ml3

Details for d3c1bh1

PDB Entry: 3c1b, 2.2 Å

PDB Description: The effect of H3 K79 dimethylation and H4 K20 trimethylation on nucleosome and chromatin structure

PDB Compounds: (H:) Histone 2, H2bf

SCOP Domain Sequences for d3c1bh1:

Sequence; same for both SEQRES and ATOM records:

>d3c1bh1 a.22.1.1 (H:1428-1521) Histone H2B {Xenopus (Silurana) tropicalis [TaxId: 8364]}
ktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstit
sreiqtavrlllpgelakhavsegtkavtkytsa

Timeline for d3c1bh1:

• d3c1bh1 is new in SCOP 1.75
  
• d3c1bh1 appears in SCOPe 2.01
  
• d3c1bh1 appears in the current release, SCOPe 2.08, called d3c1bh_