Lineage for d1outb_ (1out B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 902583Protein Hemoglobin, beta-chain [46500] (25 species)
  7. 903111Species Rainbow trout (Oncorhynchus mykiss) [TaxId:8022] [46510] (2 PDB entries)
  8. 903112Domain d1outb_: 1out B: [15579]
    Other proteins in same PDB: d1outa_
    complexed with hem

Details for d1outb_

PDB Entry: 1out (more details), 2.3 Å

PDB Description: trout hemoglobin i
PDB Compounds: (B:) hemoglobin I

SCOPe Domain Sequences for d1outb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1outb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Rainbow trout (Oncorhynchus mykiss) [TaxId: 8022]}
vewtdaekstisavwgkvnideigplalarvlivypwtqryfgsfgnvstpaaimgnpkv
aahgkvvcgaldkavknmgnilatykslsethanklfvdpdnfrvladvltiviaakfga
sftpeiqatwqkfmkvvvaamgsryf

SCOPe Domain Coordinates for d1outb_:

Click to download the PDB-style file with coordinates for d1outb_.
(The format of our PDB-style files is described here.)

Timeline for d1outb_: