| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein Hemoglobin, beta-chain [46500] (26 species) |
| Species Rainbow trout (Oncorhynchus mykiss) [TaxId:8022] [46510] (2 PDB entries) |
| Domain d1outb_: 1out B: [15579] Other proteins in same PDB: d1outa_ complexed with hem |
PDB Entry: 1out (more details), 2.3 Å
SCOPe Domain Sequences for d1outb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1outb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Rainbow trout (Oncorhynchus mykiss) [TaxId: 8022]}
vewtdaekstisavwgkvnideigplalarvlivypwtqryfgsfgnvstpaaimgnpkv
aahgkvvcgaldkavknmgnilatykslsethanklfvdpdnfrvladvltiviaakfga
sftpeiqatwqkfmkvvvaamgsryf
Timeline for d1outb_: