Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.6: Sensory domain-like [103190] (3 families) alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain |
Family d.110.6.1: Sensory domain of two-component sensor kinase [103191] (3 proteins) |
Protein automated matches [190413] (2 species) not a true protein |
Species Escherichia coli [TaxId:562] [187289] (1 PDB entry) |
Domain d3by8a_: 3by8 A: [155722] automated match to d1ojga_ complexed with mlt |
PDB Entry: 3by8 (more details), 1.45 Å
SCOPe Domain Sequences for d3by8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3by8a_ d.110.6.1 (A:) automated matches {Escherichia coli [TaxId: 562]} dmtrdglankalavartladspeirqglqkkpqesgiqaiaeavrkrndllfivvtdmqs lryshpeaqrigqpfkgddilkalngeenvainrgflaqalrvftpiydenhkqigvvai glelsrvtqqind
Timeline for d3by8a_: