Lineage for d3by8a_ (3by8 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970927Superfamily d.110.6: Sensory domain-like [103190] (5 families) (S)
    alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain
  5. 2970928Family d.110.6.1: Sensory domain of two-component sensor kinase [103191] (3 proteins)
  6. 2970944Protein automated matches [190413] (2 species)
    not a true protein
  7. 2970945Species Escherichia coli [TaxId:562] [187289] (1 PDB entry)
  8. 2970946Domain d3by8a_: 3by8 A: [155722]
    automated match to d1ojga_
    complexed with lmr

Details for d3by8a_

PDB Entry: 3by8 (more details), 1.45 Å

PDB Description: crystal structure of the e.coli dcus sensor domain
PDB Compounds: (A:) Sensor protein dcuS

SCOPe Domain Sequences for d3by8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3by8a_ d.110.6.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
dmtrdglankalavartladspeirqglqkkpqesgiqaiaeavrkrndllfivvtdmqs
lryshpeaqrigqpfkgddilkalngeenvainrgflaqalrvftpiydenhkqigvvai
glelsrvtqqind

SCOPe Domain Coordinates for d3by8a_:

Click to download the PDB-style file with coordinates for d3by8a_.
(The format of our PDB-style files is described here.)

Timeline for d3by8a_: