Lineage for d3by8a1 (3by8 A:46-178)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 870642Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 870954Superfamily d.110.6: Sensory domain-like [103190] (3 families) (S)
    alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain
  5. 870955Family d.110.6.1: Sensory domain of two-component sensor kinase [103191] (2 proteins)
  6. 870956Protein Fumarate sensor DcuS [103194] (1 species)
  7. 870957Species Escherichia coli [TaxId:562] [103195] (2 PDB entries)
  8. 870958Domain d3by8a1: 3by8 A:46-178 [155722]
    automatically matched to d1ojga_
    complexed with mlt

Details for d3by8a1

PDB Entry: 3by8 (more details), 1.45 Å

PDB Description: crystal structure of the e.coli dcus sensor domain
PDB Compounds: (A:) Sensor protein dcuS

SCOP Domain Sequences for d3by8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3by8a1 d.110.6.1 (A:46-178) Fumarate sensor DcuS {Escherichia coli [TaxId: 562]}
dmtrdglankalavartladspeirqglqkkpqesgiqaiaeavrkrndllfivvtdmqs
lryshpeaqrigqpfkgddilkalngeenvainrgflaqalrvftpiydenhkqigvvai
glelsrvtqqind

SCOP Domain Coordinates for d3by8a1:

Click to download the PDB-style file with coordinates for d3by8a1.
(The format of our PDB-style files is described here.)

Timeline for d3by8a1: