Lineage for d1hdsb_ (1hds B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 protein domains)
  6. 287Protein Hemoglobin, beta-chain [46500] (15 species)
  7. 314Species Deer (Odocoileus virginianus) [TaxId:9874] [46505] (1 PDB entry)
  8. 315Domain d1hdsb_: 1hds B: [15557]
    Other proteins in same PDB: d1hdsa_, d1hdsc_

Details for d1hdsb_

PDB Entry: 1hds (more details), 1.98 Å

PDB Description: macromolecular structure refinement by restrained least-squares and interactive graphics as applied to sickling deer type iii hemoglobin

SCOP Domain Sequences for d1hdsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdsb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Deer (Odocoileus virginianus)}
mltaeekaavtgfwgkvdvdvvgaqalgrllvvypwtqrffqhfgnlssagavmnnpkvk
ahgkrvldaftqglkhlddlkgafaqlsglhcnklhvnpqnfrllgnvlalvvarnfggq
ftpnvqalfqkvvagvanalahkyh

SCOP Domain Coordinates for d1hdsb_:

Click to download the PDB-style file with coordinates for d1hdsb_.
(The format of our PDB-style files is described here.)

Timeline for d1hdsb_: