SCOPe 2.08: Domain d3bimc_: 3bim C:

Lineage for d3bimc_ (3bim C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)

6. Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102923] (37 PDB entries)

8. Domain d3bimc_: 3bim C: [155313]
   automated match to d1r2ba_
   protein/DNA complex
   has additional insertions and/or extensions that are not grouped together

Details for d3bimc_

PDB Entry: 3bim, 2.6 Å

PDB Description: crystal structure of the bcl6 btb domain dimer in complex with the bcor bbd corepressor peptide

PDB Compounds: (C:) B-cell lymphoma 6 protein

SCOPe Domain Sequences for d3bimc_:

Sequence; same for both SEQRES and ATOM records:

>d3bimc_ d.42.1.1 (C:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]}
adsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdq
lkrnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkf
ikase

Timeline for d3bimc_:

• d3bimc_ first appeared in SCOP 1.75, called d3bimc1
  
• d3bimc_ appears in SCOPe 2.07