Lineage for d3bimc1 (3bim C:5-129)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 859355Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 859356Superfamily d.42.1: POZ domain [54695] (2 families) (S)
  5. 859357Family d.42.1.1: BTB/POZ domain [54696] (5 proteins)
  6. 859358Protein B-cell lymphoma 6 (Bcl6) protein BTB domain [102922] (1 species)
  7. 859359Species Human (Homo sapiens) [TaxId:9606] [102923] (4 PDB entries)
  8. 859367Domain d3bimc1: 3bim C:5-129 [155313]
    automatically matched to d1r2ba_
    mutant

Details for d3bimc1

PDB Entry: 3bim (more details), 2.6 Å

PDB Description: crystal structure of the bcl6 btb domain dimer in complex with the bcor bbd corepressor peptide
PDB Compounds: (C:) B-cell lymphoma 6 protein

SCOP Domain Sequences for d3bimc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bimc1 d.42.1.1 (C:5-129) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]}
adsqiqftrhasdvllnlnrlrsrdiltdvvivvsreqfrahktvlmacsglfysiftdq
lkrnlsvinldpeinpegfnilldfmytsrlnlregnimavmatamylqmehvvdtcrkf
ikase

SCOP Domain Coordinates for d3bimc1:

Click to download the PDB-style file with coordinates for d3bimc1.
(The format of our PDB-style files is described here.)

Timeline for d3bimc1: