![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.7: Calcium ATPase, transduction domain A [81653] (1 family) ![]() a distorted variant of double-helix |
![]() | Family b.82.7.1: Calcium ATPase, transduction domain A [81652] (1 protein) |
![]() | Protein Calcium ATPase, transduction domain A [81651] (1 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (14 PDB entries) Uniprot P04191 |
![]() | Domain d3b9ra1: 3b9r A:125-239 [155014] Other proteins in same PDB: d3b9ra2, d3b9ra3, d3b9ra4, d3b9rb2, d3b9rb3, d3b9rb4 automatically matched to d1iwoa1 complexed with acp, alf, k, mg |
PDB Entry: 3b9r (more details), 3 Å
SCOPe Domain Sequences for d3b9ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b9ra1 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm
Timeline for d3b9ra1:
![]() Domains from other chains: (mouse over for more information) d3b9rb1, d3b9rb2, d3b9rb3, d3b9rb4 |