Lineage for d3b9ra1 (3b9r A:125-239)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2817328Superfamily b.82.7: Metal cation-transporting ATPase, actuator domain A [81653] (1 family) (S)
    a distorted variant of double-helix
  5. 2817329Family b.82.7.1: Metal cation-transporting ATPase, actuator domain A [81652] (2 proteins)
  6. 2817330Protein Calcium ATPase, transduction domain A [81651] (1 species)
  7. 2817331Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (42 PDB entries)
    Uniprot P04191
  8. 2817362Domain d3b9ra1: 3b9r A:125-239 [155014]
    Other proteins in same PDB: d3b9ra2, d3b9ra3, d3b9ra4, d3b9rb2, d3b9rb3, d3b9rb4
    automatically matched to d1iwoa1
    complexed with acp, alf, k, mg

Details for d3b9ra1

PDB Entry: 3b9r (more details), 3 Å

PDB Description: SERCA Ca2+-ATPase E2 aluminium fluoride complex without thapsigargin
PDB Compounds: (A:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d3b9ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b9ra1 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges
vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm

SCOPe Domain Coordinates for d3b9ra1:

Click to download the PDB-style file with coordinates for d3b9ra1.
(The format of our PDB-style files is described here.)

Timeline for d3b9ra1: