Lineage for d3b9rb4 (3b9r B:1-124,B:240-343,B:751-994)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1239459Fold f.33: Calcium ATPase, transmembrane domain M [81666] (1 superfamily)
    core: multihelical; consists of three transmembrane regions of 2, 2 and 6 helices, separated by cytoplasmic domains
  4. 1239460Superfamily f.33.1: Calcium ATPase, transmembrane domain M [81665] (1 family) (S)
  5. 1239461Family f.33.1.1: Calcium ATPase, transmembrane domain M [81664] (1 protein)
  6. 1239462Protein Calcium ATPase, transmembrane domain M [81663] (1 species)
    the N-terminal 40 residues interact with /form a part of transduction domain A
  7. 1239463Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81662] (14 PDB entries)
    Uniprot P04191
  8. 1239475Domain d3b9rb4: 3b9r B:1-124,B:240-343,B:751-994 [155021]
    Other proteins in same PDB: d3b9ra1, d3b9ra2, d3b9ra3, d3b9rb1, d3b9rb2, d3b9rb3
    automatically matched to d1iwoa4
    complexed with acp, alf, k, mg

Details for d3b9rb4

PDB Entry: 3b9r (more details), 3 Å

PDB Description: SERCA Ca2+-ATPase E2 aluminium fluoride complex without thapsigargin
PDB Compounds: (B:) Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

SCOPe Domain Sequences for d3b9rb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b9rb4 f.33.1.1 (B:1-124,B:240-343,B:751-994) Calcium ATPase, transmembrane domain M {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
meaahsksteeclayfgvsettgltpdqvkrhlekyghnelpaeegkslwelvieqfedl
lvrilllaacisfvlawfeegeetitafvepfvillilianaivgvwqernaenaiealk
eyepXaateqdktplqqkldefgeqlskvislicvavwlinighfndpvhggswirgaiy
yfkiavalavaaipeglpavittclalgtrrmakknaivrslpsvetlgXraiynnmkqf
irylissnvgevvcifltaalglpealipvqllwvnlvtdglpatalgfnppdldimdrp
prspkeplisgwlffrymaiggyvgaatvgaaawwfmyaedgpgvtyhqlthfmqctedh
phfegldceifeapepmtmalsvlvtiemcnalnslsenqslmrmppwvniwllgsicls
mslhflilyvdplpmifklkaldltqwlmvlkislpvigldeilkfiarnyleg

SCOPe Domain Coordinates for d3b9rb4:

Click to download the PDB-style file with coordinates for d3b9rb4.
(The format of our PDB-style files is described here.)

Timeline for d3b9rb4: