| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (2 families) ![]() |
| Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (13 proteins) |
| Protein Xanthine oxidase, N-terminal domain [54318] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [54319] (6 PDB entries) Uniprot P80457 |
| Domain d3b9ja2: 3b9j A:3-92 [155001] Other proteins in same PDB: d3b9ja1, d3b9jb1, d3b9jb2, d3b9jc1, d3b9jc2, d3b9ji1, d3b9jj1, d3b9jj2 automatically matched to d1fiqa2 complexed with 290, ca, fad, fes, mos, mte |
PDB Entry: 3b9j (more details), 2.3 Å
SCOP Domain Sequences for d3b9ja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b9ja2 d.15.4.2 (A:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
adelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrlq
dkiihfsanaclapictlhhvavttvegig
Timeline for d3b9ja2: