Class a: All alpha proteins [46456] (284 folds) |
Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily) core: 4 helices, bundle |
Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (1 family) contains 2Fe-2S cluster |
Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (6 proteins) |
Protein Xanthine oxidase, domain 2 [47746] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [47747] (6 PDB entries) Uniprot P80457 |
Domain d3b9ja1: 3b9j A:93-164 [155000] Other proteins in same PDB: d3b9ja2, d3b9jb1, d3b9jb2, d3b9jc1, d3b9jc2, d3b9ji2, d3b9jj1, d3b9jj2 automatically matched to d1fiqa1 complexed with 290, ca, fad, fes, mos, mte |
PDB Entry: 3b9j (more details), 2.3 Å
SCOP Domain Sequences for d3b9ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b9ja1 a.56.1.1 (A:93-164) Xanthine oxidase, domain 2 {Cow (Bos taurus) [TaxId: 9913]} stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg yrpilqgfrtfa
Timeline for d3b9ja1: