Lineage for d3b9jj2 (3b9j J:224-414)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 875230Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 875231Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (4 families) (S)
  5. 875301Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (5 proteins)
  6. 875341Protein Xanthine oxidase, domain 3 (?) [56191] (1 species)
  7. 875342Species Cow (Bos taurus) [TaxId:9913] [56192] (6 PDB entries)
    Uniprot P80457
  8. 875350Domain d3b9jj2: 3b9j J:224-414 [155009]
    Other proteins in same PDB: d3b9ja1, d3b9ja2, d3b9jb1, d3b9jc1, d3b9jc2, d3b9ji1, d3b9ji2, d3b9jj1
    automatically matched to d1fiqb2
    complexed with 290, ca, fad, fes, mos, mte

Details for d3b9jj2

PDB Entry: 3b9j (more details), 2.3 Å

PDB Description: Structure of Xanthine Oxidase with 2-hydroxy-6-methylpurine
PDB Compounds: (J:) xanthine oxidase

SCOP Domain Sequences for d3b9jj2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b9jj2 d.145.1.3 (J:224-414) Xanthine oxidase, domain 3 (?) {Cow (Bos taurus) [TaxId: 9913]}
pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw
ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk
svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei
llsieipysre

SCOP Domain Coordinates for d3b9jj2:

Click to download the PDB-style file with coordinates for d3b9jj2.
(The format of our PDB-style files is described here.)

Timeline for d3b9jj2: