Lineage for d3b9jc2 (3b9j C:695-1328)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 873313Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 873314Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (1 family) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
  5. 873315Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (6 proteins)
  6. 873361Protein Xanthine oxidase, C-terminal domain [56008] (1 species)
  7. 873362Species Cow (Bos taurus) [TaxId:9913] [56009] (6 PDB entries)
    Uniprot P80457
  8. 873369Domain d3b9jc2: 3b9j C:695-1328 [155005]
    Other proteins in same PDB: d3b9ja1, d3b9ja2, d3b9jb1, d3b9jb2, d3b9jc1, d3b9ji1, d3b9ji2, d3b9jj1, d3b9jj2
    automatically matched to d1fo4a5
    complexed with 290, ca, fad, fes, mos, mte

Details for d3b9jc2

PDB Entry: 3b9j (more details), 2.3 Å

PDB Description: Structure of Xanthine Oxidase with 2-hydroxy-6-methylpurine
PDB Compounds: (C:) xanthine oxidase

SCOP Domain Sequences for d3b9jc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b9jc2 d.133.1.1 (C:695-1328) Xanthine oxidase, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
iitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethctiaipk
geegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsvaval
aayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagnsrdls
hsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsevavtc
glpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnkencwk
krglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqvaskal
kipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpdgswe
dwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgdhknl
rtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykipafgs
iptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnntkelf
rldspatpekirnacvdkfttlcvtgapgnckpw

SCOP Domain Coordinates for d3b9jc2:

Click to download the PDB-style file with coordinates for d3b9jc2.
(The format of our PDB-style files is described here.)

Timeline for d3b9jc2: