Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) repeats organized in elongated structures |
Family d.211.1.1: Ankyrin repeat [48404] (18 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
Protein automated matches [190101] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187689] (4 PDB entries) |
Domain d3b7ba1: 3b7b A:879-954 [154927] automatically matched to d1n0qb_ complexed with so4 |
PDB Entry: 3b7b (more details), 2.99 Å
SCOPe Domain Sequences for d3b7ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b7ba1 d.211.1.1 (A:879-954) automated matches {Human (Homo sapiens) [TaxId: 9606]} lhwaafsgcvdiaeillaakcdlhavnihgdsplhiaarenrydcvvlflsrdsdvtlkn kegetplqcaslnsqv
Timeline for d3b7ba1: