SCOPe 2.02: Domain d3b7ba1: 3b7b A:879-954

Lineage for d3b7ba1 (3b7b A:879-954)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (18 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein automated matches [190101] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187689] (4 PDB entries)

8. Domain d3b7ba1: 3b7b A:879-954 [154927]
   automatically matched to d1n0qb_
   complexed with so4

Details for d3b7ba1

PDB Entry: 3b7b, 2.99 Å

PDB Description: EuHMT1 (Glp) Ankyrin Repeat Domain (Structure 1)

PDB Compounds: (A:) Euchromatic histone-lysine N-methyltransferase 1

SCOPe Domain Sequences for d3b7ba1:

Sequence; same for both SEQRES and ATOM records:

>d3b7ba1 d.211.1.1 (A:879-954) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lhwaafsgcvdiaeillaakcdlhavnihgdsplhiaarenrydcvvlflsrdsdvtlkn
kegetplqcaslnsqv

Timeline for d3b7ba1:

• d3b7ba1 first appeared in SCOP 1.75
  
• d3b7ba1 appears in SCOPe 2.01
  
• d3b7ba1 appears in SCOPe 2.03
  
• d3b7ba1 appears in the current release, SCOPe 2.08, called d3b7ba2