Lineage for d3b7ba1 (3b7b A:879-954)

  1. Root: SCOP 1.75
  2. 900990Class k: Designed proteins [58788] (44 folds)
  3. 901610Fold k.37: Artificial ankyrin repeat proteins [83017] (1 superfamily)
  4. 901611Superfamily k.37.1: Artificial ankyrin repeat proteins [83018] (1 family) (S)
  5. 901612Family k.37.1.1: Artificial ankyrin repeat proteins [83019] (4 proteins)
  6. 901613Protein 3ank [83022] (4 species)
  7. 901614Species Homo sapiens [TaxId:9606] [161331] (2 PDB entries)
  8. 901616Domain d3b7ba1: 3b7b A:879-954 [154927]
    automatically matched to d1n0qb_

Details for d3b7ba1

PDB Entry: 3b7b (more details), 2.99 Å

PDB Description: EuHMT1 (Glp) Ankyrin Repeat Domain (Structure 1)
PDB Compounds: (A:) Euchromatic histone-lysine N-methyltransferase 1

SCOP Domain Sequences for d3b7ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b7ba1 k.37.1.1 (A:879-954) 3ank {Homo sapiens [TaxId: 9606]}
lhwaafsgcvdiaeillaakcdlhavnihgdsplhiaarenrydcvvlflsrdsdvtlkn
kegetplqcaslnsqv

SCOP Domain Coordinates for d3b7ba1:

Click to download the PDB-style file with coordinates for d3b7ba1.
(The format of our PDB-style files is described here.)

Timeline for d3b7ba1: