Class k: Designed proteins [58788] (44 folds) |
Fold k.37: Artificial ankyrin repeat proteins [83017] (1 superfamily) |
Superfamily k.37.1: Artificial ankyrin repeat proteins [83018] (1 family) |
Family k.37.1.1: Artificial ankyrin repeat proteins [83019] (4 proteins) |
Protein 3ank [83022] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [161331] (2 PDB entries) |
Domain d3b7ba1: 3b7b A:879-954 [154927] automatically matched to d1n0qb_ complexed with so4 |
PDB Entry: 3b7b (more details), 2.99 Å
SCOPe Domain Sequences for d3b7ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b7ba1 k.37.1.1 (A:879-954) 3ank {Human (Homo sapiens) [TaxId: 9606]} lhwaafsgcvdiaeillaakcdlhavnihgdsplhiaarenrydcvvlflsrdsdvtlkn kegetplqcaslnsqv
Timeline for d3b7ba1: