Lineage for d3b7ba1 (3b7b A:879-954)

  1. Root: SCOPe 2.01
  2. 1074148Class k: Designed proteins [58788] (44 folds)
  3. 1074768Fold k.37: Artificial ankyrin repeat proteins [83017] (1 superfamily)
  4. 1074769Superfamily k.37.1: Artificial ankyrin repeat proteins [83018] (1 family) (S)
  5. 1074770Family k.37.1.1: Artificial ankyrin repeat proteins [83019] (4 proteins)
  6. 1074771Protein 3ank [83022] (4 species)
  7. 1074772Species Human (Homo sapiens) [TaxId:9606] [161331] (2 PDB entries)
  8. 1074774Domain d3b7ba1: 3b7b A:879-954 [154927]
    automatically matched to d1n0qb_
    complexed with so4

Details for d3b7ba1

PDB Entry: 3b7b (more details), 2.99 Å

PDB Description: EuHMT1 (Glp) Ankyrin Repeat Domain (Structure 1)
PDB Compounds: (A:) Euchromatic histone-lysine N-methyltransferase 1

SCOPe Domain Sequences for d3b7ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b7ba1 k.37.1.1 (A:879-954) 3ank {Human (Homo sapiens) [TaxId: 9606]}
lhwaafsgcvdiaeillaakcdlhavnihgdsplhiaarenrydcvvlflsrdsdvtlkn
kegetplqcaslnsqv

SCOPe Domain Coordinates for d3b7ba1:

Click to download the PDB-style file with coordinates for d3b7ba1.
(The format of our PDB-style files is described here.)

Timeline for d3b7ba1: