Lineage for d3b3qe_ (3b3q E:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1532832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1532833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1533772Family b.29.1.4: Laminin G-like module [49944] (7 proteins)
  6. 1533798Protein Ligand-binding domain of neurexin 1beta [49949] (3 species)
  7. 1533804Species Human (Homo sapiens) [TaxId:9606] [158985] (1 PDB entry)
  8. 1533805Domain d3b3qe_: 3b3q E: [154813]
    Other proteins in same PDB: d3b3qa_, d3b3qb_
    automated match to d1c4rg_
    complexed with ca, nag

Details for d3b3qe_

PDB Entry: 3b3q (more details), 2.4 Å

PDB Description: crystal structure of a synaptic adhesion complex
PDB Compounds: (E:) NRXN1 protein

SCOPe Domain Sequences for d3b3qe_:

Sequence, based on SEQRES records: (download)

>d3b3qe_ b.29.1.4 (E:) Ligand-binding domain of neurexin 1beta {Human (Homo sapiens) [TaxId: 9606]}
hsafaadpghagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdss
sglgdylelhihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdsw
pvierypagrqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaiv
gnvrlvgev

Sequence, based on observed residues (ATOM records): (download)

>d3b3qe_ b.29.1.4 (E:) Ligand-binding domain of neurexin 1beta {Human (Homo sapiens) [TaxId: 9606]}
hsafaadpghttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssg
lgdylelhihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpv
ierypagrqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgn
vrlvgev

SCOPe Domain Coordinates for d3b3qe_:

Click to download the PDB-style file with coordinates for d3b3qe_.
(The format of our PDB-style files is described here.)

Timeline for d3b3qe_: