Lineage for d1c4rg_ (1c4r G:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1532832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1532833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1533772Family b.29.1.4: Laminin G-like module [49944] (7 proteins)
  6. 1533798Protein Ligand-binding domain of neurexin 1beta [49949] (3 species)
  7. 1533807Species Norway rat (Rattus norvegicus) [TaxId:10116] [49950] (5 PDB entries)
  8. 1533825Domain d1c4rg_: 1c4r G: [24235]

Details for d1c4rg_

PDB Entry: 1c4r (more details), 2.6 Å

PDB Description: the structure of the ligand-binding domain of neurexin 1beta: regulation of lns domain function by alternative splicing
PDB Compounds: (G:) neurexin-I beta

SCOPe Domain Sequences for d1c4rg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c4rg_ b.29.1.4 (G:) Ligand-binding domain of neurexin 1beta {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ghagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdyle
lhihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypa
grqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlvge
vp

SCOPe Domain Coordinates for d1c4rg_:

Click to download the PDB-style file with coordinates for d1c4rg_.
(The format of our PDB-style files is described here.)

Timeline for d1c4rg_: