Lineage for d3b3qe1 (3b3q E:81-291)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 794080Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 794081Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 794771Family b.29.1.4: Laminin G-like module [49944] (6 proteins)
  6. 794797Protein Ligand-binding domain of neurexin 1beta [49949] (2 species)
  7. 794798Species Homo sapiens [TaxId:9606] [158985] (1 PDB entry)
  8. 794799Domain d3b3qe1: 3b3q E:81-291 [154813]
    automatically matched to d1c4rg_
    complexed with ca, nag; mutant

Details for d3b3qe1

PDB Entry: 3b3q (more details), 2.4 Å

PDB Description: crystal structure of a synaptic adhesion complex
PDB Compounds: (E:) NRXN1 protein

SCOP Domain Sequences for d3b3qe1:

Sequence, based on SEQRES records: (download)

>d3b3qe1 b.29.1.4 (E:81-291) Ligand-binding domain of neurexin 1beta {Homo sapiens [TaxId: 9606]}
ghagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdyle
lhihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypa
grqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlvge
v

Sequence, based on observed residues (ATOM records): (download)

>d3b3qe1 b.29.1.4 (E:81-291) Ligand-binding domain of neurexin 1beta {Homo sapiens [TaxId: 9606]}
ghttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdylelh
ihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypagr
qltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlvgev

SCOP Domain Coordinates for d3b3qe1:

Click to download the PDB-style file with coordinates for d3b3qe1.
(The format of our PDB-style files is described here.)

Timeline for d3b3qe1: