SCOPe 2.04: Domain d2zodb1: 2zod B:3-154

Lineage for d2zodb1 (2zod B:3-154)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families)

5. Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins)

6. Protein Selenide, water dikinase SelD [160511] (1 species)
7. Species Aquifex aeolicus [TaxId:63363] [160512] (3 PDB entries)
   Uniprot O67139 1-154! Uniprot O67139 28-154

8. Domain d2zodb1: 2zod B:3-154 [154720]
   Other proteins in same PDB: d2zoda2, d2zodb2
   automated match to d2yyea1
   complexed with so4

Details for d2zodb1

PDB Entry: 2zod, 1.98 Å

PDB Description: Crystal structure of selenophosphate synthetase from Aquifex aeolicus

PDB Compounds: (B:) Selenide, water dikinase

SCOPe Domain Sequences for d2zodb1:

Sequence, based on SEQRES records:

>d2zodb1 d.79.4.1 (B:3-154) Selenide, water dikinase SelD {Aquifex aeolicus [TaxId: 63363]}
ellklvrssgcaakvgpgdlqeilkgfniytdestlvsigddagvyehngiiwvytvdii
tpvvndpylwgaistanalsdvyamggipvnalaiscfnnceldieifrevirgaldklr
eaktvllgghtiddkepkfglsvagicpegky

Sequence, based on observed residues (ATOM records):

>d2zodb1 d.79.4.1 (B:3-154) Selenide, water dikinase SelD {Aquifex aeolicus [TaxId: 63363]}
ellklvrsslqeilkgfniytdestlvsiagvyehngiiwvytvdiitpvvndpylwgai
stanalsdvyamggipvnalaiscfnnceldieifrevirgaldklreaktvllgghtid
dkepkfglsvagicpegky

Timeline for d2zodb1:

• d2zodb1 first appeared in SCOP 1.75
  
• d2zodb1 appears in SCOPe 2.03
  
• d2zodb1 appears in SCOPe 2.05
  
• d2zodb1 appears in the current release, SCOPe 2.08