SCOPe 2.04: Domain d2zoda2: 2zod A:155-336

Lineage for d2zoda2 (2zod A:155-336)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families)

5. Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins)

6. Protein Selenide, water dikinase SelD [160785] (1 species)
7. Species Aquifex aeolicus [TaxId:63363] [160786] (3 PDB entries)
   Uniprot O67139 155-336

8. Domain d2zoda2: 2zod A:155-336 [154719]
   Other proteins in same PDB: d2zoda1, d2zodb1
   automated match to d2yyea2
   complexed with so4

Details for d2zoda2

PDB Entry: 2zod, 1.98 Å

PDB Description: Crystal structure of selenophosphate synthetase from Aquifex aeolicus

PDB Compounds: (A:) Selenide, water dikinase

SCOPe Domain Sequences for d2zoda2:

Sequence; same for both SEQRES and ATOM records:

>d2zoda2 d.139.1.1 (A:155-336) Selenide, water dikinase SelD {Aquifex aeolicus [TaxId: 63363]}
itqsgaqvgqlliltkpigtgilikglkegilkeedineaienmlalndkarnlmlslda
tactdvtgfgllghawnicknsnigariffekvpyyqlsenlvkkkiypkgaienlnfvk
nylksnldnwklillsdpvtsggllftinkeklekidetakelevnywiigetiaenvle
vl

Timeline for d2zoda2:

• d2zoda2 first appeared in SCOP 1.75
  
• d2zoda2 appears in SCOPe 2.03
  
• d2zoda2 appears in SCOPe 2.05
  
• d2zoda2 appears in the current release, SCOPe 2.08