Lineage for d2zoda2 (2zod A:155-336)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978140Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 2978141Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 2978142Family d.139.1.1: PurM C-terminal domain-like [56043] (9 proteins)
  6. 2978195Protein Selenide, water dikinase SelD [160785] (1 species)
  7. 2978196Species Aquifex aeolicus [TaxId:63363] [160786] (4 PDB entries)
    Uniprot O67139 155-336
  8. 2978201Domain d2zoda2: 2zod A:155-336 [154719]
    Other proteins in same PDB: d2zoda1, d2zodb1
    automated match to d2yyea2
    complexed with so4

Details for d2zoda2

PDB Entry: 2zod (more details), 1.98 Å

PDB Description: Crystal structure of selenophosphate synthetase from Aquifex aeolicus
PDB Compounds: (A:) Selenide, water dikinase

SCOPe Domain Sequences for d2zoda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zoda2 d.139.1.1 (A:155-336) Selenide, water dikinase SelD {Aquifex aeolicus [TaxId: 63363]}
itqsgaqvgqlliltkpigtgilikglkegilkeedineaienmlalndkarnlmlslda
tactdvtgfgllghawnicknsnigariffekvpyyqlsenlvkkkiypkgaienlnfvk
nylksnldnwklillsdpvtsggllftinkeklekidetakelevnywiigetiaenvle
vl

SCOPe Domain Coordinates for d2zoda2:

Click to download the PDB-style file with coordinates for d2zoda2.
(The format of our PDB-style files is described here.)

Timeline for d2zoda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zoda1