Lineage for d2yyea1 (2yye A:1-154)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1657490Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1658121Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) (S)
  5. 1658122Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins)
  6. Protein Selenide, water dikinase SelD [160511] (1 species)
  7. Species Aquifex aeolicus [TaxId:63363] [160512] (3 PDB entries)
    Uniprot O67139 1-154! Uniprot O67139 28-154
  8. 1658176Domain d2yyea1: 2yye A:1-154 [153831]
    Other proteins in same PDB: d2yyea2, d2yyeb2
    complexed with apc, co, po4

Details for d2yyea1

PDB Entry: 2yye (more details), 2.1 Å

PDB Description: Crystal structure of selenophosphate synthetase from Aquifex aeolicus complexed with AMPCPP
PDB Compounds: (A:) Selenide, water dikinase

SCOPe Domain Sequences for d2yyea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yyea1 d.79.4.1 (A:1-154) Selenide, water dikinase SelD {Aquifex aeolicus [TaxId: 63363]}
mvellklvrssgcaakvgpgdlqeilkgfniytdestlvsigddagvyehngiiwvytvd
iitpvvndpylwgaistanalsdvyamggipvnalaiscfnnceldieifrevirgaldk
lreaktvllgghtiddkepkfglsvagicpegky

SCOPe Domain Coordinates for d2yyea1:

Click to download the PDB-style file with coordinates for d2yyea1.
(The format of our PDB-style files is described here.)

Timeline for d2yyea1:

1658176
d2yyea1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2yyea2