SCOPe 2.07: Domain d2zmla_: 2zml A:

Lineage for d2zmla_ (2zml A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (13 PDB entries)

8. Domain d2zmla_: 2zml A: [154697]
   automated match to d1wbfa_
   complexed with ca, mn, nag

Details for d2zmla_

PDB Entry: 2zml, 2.65 Å

PDB Description: crystal structure of basic winged bean lectin in complex with gal- alpha 1,4 gal

PDB Compounds: (A:) Basic agglutinin

SCOPe Domain Sequences for d2zmla_:

Sequence; same for both SEQRES and ATOM records:

>d2zmla_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg

Timeline for d2zmla_:

• d2zmla_ first appeared in SCOP 1.75, called d2zmla1
  
• d2zmla_ appears in SCOPe 2.06
  
• d2zmla_ appears in the current release, SCOPe 2.08