SCOP 1.75: Domain d2zmla1: 2zml A:1-236

Lineage for d2zmla1 (2zml A:1-236)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (14 PDB entries)

8. Domain d2zmla1: 2zml A:1-236 [154697]
   automatically matched to d1wbfa_
   complexed with ca, fuc, gla, mn, nag

Details for d2zmla1

PDB Entry: 2zml, 2.65 Å

PDB Description: crystal structure of basic winged bean lectin in complex with gal- alpha 1,4 gal

PDB Compounds: (A:) Basic agglutinin

SCOP Domain Sequences for d2zmla1:

Sequence; same for both SEQRES and ATOM records:

>d2zmla1 b.29.1.1 (A:1-236) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslp

Timeline for d2zmla1:

• d2zmla1 is new in SCOP 1.75
  
• d2zmla1 is called d2zmla_ in SCOPe 2.01
  
• d2zmla1 appears in the current release, SCOPe 2.08, called d2zmla_