![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
![]() | Family b.29.1.1: Legume lectins [49900] (5 proteins) |
![]() | Protein Legume lectin [49904] (23 species) |
![]() | Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (13 PDB entries) |
![]() | Domain d2zmld_: 2zml D: [154700] automated match to d1wbfa_ complexed with ca, mn, nag |
PDB Entry: 2zml (more details), 2.65 Å
SCOPe Domain Sequences for d2zmld_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zmld_ b.29.1.1 (D:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg
Timeline for d2zmld_: