| Class b: All beta proteins [48724] (177 folds) |
| Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) ![]() peptide-binding domain |
| Family b.36.1.4: HtrA-like serine proteases [74933] (4 proteins) |
| Protein Protease Do (DegP, HtrA), C-terminal domains [74934] (1 species) duplication: tandem repeat of two PDZ domains |
| Species Escherichia coli [TaxId:562] [74935] (4 PDB entries) |
| Domain d2zlel2: 2zle L:4620-4702 [154663] Other proteins in same PDB: d2zlea3, d2zleb3, d2zlec3, d2zlee3, d2zlef3, d2zleg3, d2zleh3, d2zlei3, d2zlej3, d2zlek3, d2zlel3, d2zlem3 automatically matched to d1ky9b2 |
PDB Entry: 2zle (more details), 28 Å
SCOPe Domain Sequences for d2zlel2:
Sequence, based on SEQRES records: (download)
>d2zlel2 b.36.1.4 (L:4620-4702) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]}
qnqvdsssifngiegaemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiganqqavkni
aelrkvldskpsvlalniqrgdstiyll
>d2zlel2 b.36.1.4 (L:4620-4702) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]}
qnqvdsssifnemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiganqqavkniaelrk
vldskpsvlalniqrgdstiyll
Timeline for d2zlel2:
View in 3DDomains from other chains: (mouse over for more information) d2zlea1, d2zlea2, d2zlea3, d2zleb1, d2zleb2, d2zleb3, d2zlec1, d2zlec2, d2zlec3, d2zlee1, d2zlee2, d2zlee3, d2zlef1, d2zlef2, d2zlef3, d2zleg1, d2zleg2, d2zleg3, d2zleh1, d2zleh2, d2zleh3, d2zlei1, d2zlei2, d2zlei3, d2zlej1, d2zlej2, d2zlej3, d2zlek1, d2zlek2, d2zlek3, d2zlem1, d2zlem2, d2zlem3 |