SCOPe 2.06: Domain d2zleg2: 2zle G:2640-2722

Lineage for d2zleg2 (2zle G:2640-2722)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.4: HtrA-like serine proteases [74933] (4 proteins)

6. Protein Protease Do (DegP, HtrA), C-terminal domains [74934] (1 species)
   duplication: tandem repeat of two PDZ domains

7. Species Escherichia coli [TaxId:562] [74935] (4 PDB entries)

8. Domain d2zleg2: 2zle G:2640-2722 [154648]
   Other proteins in same PDB: d2zlea3, d2zleb3, d2zlec3, d2zlee3, d2zlef3, d2zleg3, d2zleh3, d2zlei3, d2zlej3, d2zlek3, d2zlel3, d2zlem3
   automatically matched to d1ky9b2

Details for d2zleg2

PDB Entry: 2zle, 28 Å

PDB Description: cryo-em structure of degp12/omp

PDB Compounds: (G:) Protease do

SCOPe Domain Sequences for d2zleg2:

Sequence, based on SEQRES records:

>d2zleg2 b.36.1.4 (G:2640-2722) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]}
qnqvdsssifngiegaemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiganqqavkni
aelrkvldskpsvlalniqrgdstiyll

Sequence, based on observed residues (ATOM records):

>d2zleg2 b.36.1.4 (G:2640-2722) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]}
qnqvdsssifnemsnkgkdqgvvvnnvktgtpaaqiglkkgdviiganqqavkniaelrk
vldskpsvlalniqrgdstiyll

Timeline for d2zleg2:

• d2zleg2 first appeared in SCOP 1.75
  
• d2zleg2 appears in SCOPe 2.05
  
• d2zleg2 appears in SCOPe 2.07
  
• d2zleg2 appears in the current release, SCOPe 2.08