![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, beta-chain [46500] (26 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46501] (289 PDB entries) Uniprot P68871 |
![]() | Domain d1c7db_: 1c7d B: [15457] Other proteins in same PDB: d1c7da1, d1c7da2 recombinant hemoglobin rhb1.2 complexed with hem |
PDB Entry: 1c7d (more details), 1.8 Å
SCOPe Domain Sequences for d1c7db_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c7db_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]} mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgkvlvcvlahhfgk eftppvqaayqkvvagvanalahkyh
Timeline for d1c7db_: