Lineage for d1c7db_ (1c7d B:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 287Protein Hemoglobin, beta-chain [46500] (15 species)
  7. 329Species Human (Homo sapiens) [TaxId:9606] [46501] (71 PDB entries)
  8. 373Domain d1c7db_: 1c7d B: [15457]
    Other proteins in same PDB: d1c7da1, d1c7da2

Details for d1c7db_

PDB Entry: 1c7d (more details), 1.8 Å

PDB Description: deoxy rhb1.2 (recombinant hemoglobin)

SCOP Domain Sequences for d1c7db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c7db_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens)}
mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgkvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOP Domain Coordinates for d1c7db_:

Click to download the PDB-style file with coordinates for d1c7db_.
(The format of our PDB-style files is described here.)

Timeline for d1c7db_: