| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
| Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
| Protein automated matches [190509] (14 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226129] (14 PDB entries) |
| Domain d2zcyf_: 2zcy F: [154359] Other proteins in same PDB: d2zcy0_, d2zcy1_, d2zcya_, d2zcyb_, d2zcyc_, d2zcyd_, d2zcye_, d2zcyg_, d2zcyh_, d2zcyi_, d2zcyj_, d2zcyk_, d2zcyl_, d2zcym_, d2zcyn_, d2zcyo_, d2zcyp_, d2zcyq_, d2zcyr_, d2zcys_, d2zcyu_, d2zcyv_, d2zcyw_, d2zcyx_, d2zcyy_, d2zcyz_ automated match to d1irug_ complexed with srg |
PDB Entry: 2zcy (more details), 2.9 Å
SCOPe Domain Sequences for d2zcyf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zcyf_ d.153.1.0 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
kein
Timeline for d2zcyf_:
View in 3DDomains from other chains: (mouse over for more information) d2zcy0_, d2zcy1_, d2zcya_, d2zcyb_, d2zcyc_, d2zcyd_, d2zcye_, d2zcyg_, d2zcyh_, d2zcyi_, d2zcyj_, d2zcyk_, d2zcyl_, d2zcym_, d2zcyn_, d2zcyo_, d2zcyp_, d2zcyq_, d2zcyr_, d2zcys_, d2zcyt_, d2zcyu_, d2zcyv_, d2zcyw_, d2zcyx_, d2zcyy_, d2zcyz_ |