SCOPe 2.08: Domain d2zcyf_: 2zcy F:

Lineage for d2zcyf_ (2zcy F:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.0: automated matches [191393] (1 protein)
   not a true family

6. Protein automated matches [190509] (19 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226129] (16 PDB entries)

8. Domain d2zcyf_: 2zcy F: [154359]
   Other proteins in same PDB: d2zcy0_, d2zcy1_, d2zcya_, d2zcyb_, d2zcyc2, d2zcyc3, d2zcyd_, d2zcye_, d2zcyg_, d2zcyh_, d2zcyi_, d2zcyj_, d2zcyk_, d2zcyl_, d2zcym_, d2zcyn_, d2zcyo_, d2zcyp_, d2zcyq2, d2zcyq3, d2zcyr_, d2zcys_, d2zcyu_, d2zcyv_, d2zcyw_, d2zcyx_, d2zcyy_, d2zcyz_
   automated match to d1irug_
   complexed with srg

Details for d2zcyf_

PDB Entry: 2zcy, 2.9 Å

PDB Description: yeast 20S proteasome:syringolin A-complex

PDB Compounds: (F:) Proteasome component C1

SCOPe Domain Sequences for d2zcyf_:

Sequence; same for both SEQRES and ATOM records:

>d2zcyf_ d.153.1.0 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
kein

Timeline for d2zcyf_:

• d2zcyf_ first appeared in SCOP 1.75, called d2zcyf1
  
• d2zcyf_ appears in SCOPe 2.07