| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
| Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
| Protein Proteasome beta subunit (catalytic) [56252] (6 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (174 PDB entries) The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8) |
| Domain d2zcy0_: 2zcy 0: [154353] Other proteins in same PDB: d2zcya_, d2zcyb_, d2zcyc_, d2zcyd_, d2zcye_, d2zcyf_, d2zcyg_, d2zcyh_, d2zcyl_, d2zcyo_, d2zcyp_, d2zcyq_, d2zcyr_, d2zcys_, d2zcyt_, d2zcyu_, d2zcyv_, d2zcyz_ automated match to d1g0um_ complexed with srg |
PDB Entry: 2zcy (more details), 2.9 Å
SCOPe Domain Sequences for d2zcy0_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zcy0_ d.153.1.4 (0:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tqqpivtgtsvismkydngviiaadnlgsygsllrfngverlipvgdntvvgisgdisdm
qhierllkdlvtenaydnpladaeealepsyifeylatvmyqrrskmnplwnaiivagvq
sngdqflryvnllgvtyssptlatgfgahmanpllrkvvdresdipkttvqvaeeaivna
mrvlyyrdarssrnfslaiidkntgltfkknlqvenmkwdfakdikgygtqki
Timeline for d2zcy0_:
View in 3DDomains from other chains: (mouse over for more information) d2zcy1_, d2zcya_, d2zcyb_, d2zcyc_, d2zcyd_, d2zcye_, d2zcyf_, d2zcyg_, d2zcyh_, d2zcyi_, d2zcyj_, d2zcyk_, d2zcyl_, d2zcym_, d2zcyn_, d2zcyo_, d2zcyp_, d2zcyq_, d2zcyr_, d2zcys_, d2zcyt_, d2zcyu_, d2zcyv_, d2zcyw_, d2zcyx_, d2zcyy_, d2zcyz_ |