Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein automated matches [190100] (10 species) not a true protein |
Species Aeropyrum pernix [TaxId:56636] [187260] (1 PDB entry) |
Domain d2zcte_: 2zct E: [154347] automated match to d1x0ra1 |
PDB Entry: 2zct (more details), 1.7 Å
SCOPe Domain Sequences for d2zcte_:
Sequence, based on SEQRES records: (download)
>d2zcte_ c.47.1.10 (E:) automated matches {Aeropyrum pernix [TaxId: 56636]} ipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarryedf qrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesatht vrgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneiigeg livpppttedqararmesgqyrsldwwfcwdtpasrddveearrylrraaekpakllyee
>d2zcte_ c.47.1.10 (E:) automated matches {Aeropyrum pernix [TaxId: 56636]} ipligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarryedf qrlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllathtvrgv fivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneiigeglivp ppttedqararmesgqyrsldwwfcwdtpasrddveearrylrraaekpakllyee
Timeline for d2zcte_: