![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
![]() | Protein automated matches [190100] (10 species) not a true protein |
![]() | Species Aeropyrum pernix [TaxId:56636] [187260] (1 PDB entry) |
![]() | Domain d2zcta_: 2zct A: [154343] automated match to d1x0ra1 |
PDB Entry: 2zct (more details), 1.7 Å
SCOPe Domain Sequences for d2zcta_:
Sequence, based on SEQRES records: (download)
>d2zcta_ c.47.1.10 (A:) automated matches {Aeropyrum pernix [TaxId: 56636]} pligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarryedfq rlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllhaesathtv rgvfivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneiigegl ivpppttedqararmesgqyrsldwwfcwdtpasrddveearrylrraaekpakllyeea
>d2zcta_ c.47.1.10 (A:) automated matches {Aeropyrum pernix [TaxId: 56636]} pligerfpemevttdhgviklpdhyvsqgkwfvlfshpadftpvcttefvsfarryedfq rlgvdliglsvdsvfshikwkewierhigvripfpiiadpqgtvarrlgllathtvrgvf ivdargvirtmlyypmelgrlvdeilrivkalklgdslkravpadwpnneiigeglivpp pttedqararmesgqyrsldwwfcwdtpasrddveearrylrraaekpakllyeea
Timeline for d2zcta_: