Lineage for d1c40a_ (1c40 A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 94Protein Hemoglobin, alpha-chain [46486] (13 species)
  7. 99Species Bar-headed goose (Anser indicus) [TaxId:8846] [46493] (3 PDB entries)
  8. 101Domain d1c40a_: 1c40 A: [15395]
    Other proteins in same PDB: d1c40b_

Details for d1c40a_

PDB Entry: 1c40 (more details), 2.3 Å

PDB Description: bar-headed goose hemoglobin (aquomet form)

SCOP Domain Sequences for d1c40a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c40a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Bar-headed goose (Anser indicus)}
vlsaadktnvkgvfskisghaeeygaetlermftaypqtktyfphfdlqhgsaqikahgk
kvvaalveavnhiddiagalsklsnlhaqklrvdpvnfkflghcflvvvaihhpsaltae
vhasldkflcavgtvltakyr

SCOP Domain Coordinates for d1c40a_:

Click to download the PDB-style file with coordinates for d1c40a_.
(The format of our PDB-style files is described here.)

Timeline for d1c40a_: