SCOPe 2.02: Domain d2yzib_: 2yzi B:

Lineage for d2yzib_ (2yzi B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.37: CBS-domain pair [54630] (1 superfamily)
   duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a

4. Superfamily d.37.1: CBS-domain pair [54631] (2 families)

5. Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
   Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain

6. Protein automated matches [190627] (4 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:53953] [188263] (1 PDB entry)

8. Domain d2yzib_: 2yzi B: [153903]
   Other proteins in same PDB: d2yzia1
   automated match to d2yzia1

Details for d2yzib_

PDB Entry: 2yzi, 2.25 Å

PDB Description: Crystal structure of uncharacterized conserved protein from Pyrococcus horikoshii

PDB Compounds: (B:) Hypothetical protein PH0107

SCOPe Domain Sequences for d2yzib_:

Sequence; same for both SEQRES and ATOM records:

>d2yzib_ d.37.1.1 (B:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
mdmkapikvymtkkllgvkpstsvqeasrlmmefdvgslvvinddgnvvgfftksdiirr
vivpglpydipverimtrnlitanvntplgevlrkmaehrikhilieeegkivgiftlsd
lleasrrrletaisae

Timeline for d2yzib_:

• d2yzib_ first appeared in SCOP 1.75, called d2yzib1
  
• d2yzib_ appears in SCOPe 2.01
  
• d2yzib_ appears in SCOPe 2.03
  
• d2yzib_ appears in the current release, SCOPe 2.08