Lineage for d2yzia1 (2yzi A:4-135)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1200936Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 1200937Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 1200938Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 1201029Protein Uncharacterized protein PH0107 [160168] (1 species)
  7. 1201030Species Pyrococcus horikoshii [TaxId:53953] [160169] (1 PDB entry)
    Uniprot O57847 4-135
  8. 1201031Domain d2yzia1: 2yzi A:4-135 [153902]
    Other proteins in same PDB: d2yzib_

Details for d2yzia1

PDB Entry: 2yzi (more details), 2.25 Å

PDB Description: Crystal structure of uncharacterized conserved protein from Pyrococcus horikoshii
PDB Compounds: (A:) Hypothetical protein PH0107

SCOPe Domain Sequences for d2yzia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]}
mdmkapikvymtkkllgvkpstsvqeasrlmmefdvgslvvinddgnvvgfftksdiirr
vivpglpydipverimtrnlitanvntplgevlrkmaehrikhilieeegkivgiftlsd
lleasrrrleta

SCOPe Domain Coordinates for d2yzia1:

Click to download the PDB-style file with coordinates for d2yzia1.
(The format of our PDB-style files is described here.)

Timeline for d2yzia1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2yzib_