SCOPe 2.02: Domain d2yyeb1: 2yye B:1-154

Lineage for d2yyeb1 (2yye B:1-154)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.4: PurM N-terminal domain-like [55326] (1 family)

5. Family d.79.4.1: PurM N-terminal domain-like [55327] (6 proteins)

6. Protein Selenide, water dikinase SelD [160511] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [160512] (3 PDB entries)
   Uniprot O67139 1-154! Uniprot O67139 28-154

8. Domain d2yyeb1: 2yye B:1-154 [153833]
   Other proteins in same PDB: d2yyea2, d2yyeb2
   automatically matched to 2YYE A:1-154
   complexed with apc, co, po4

Details for d2yyeb1

PDB Entry: 2yye, 2.1 Å

PDB Description: Crystal structure of selenophosphate synthetase from Aquifex aeolicus complexed with AMPCPP

PDB Compounds: (B:) Selenide, water dikinase

SCOPe Domain Sequences for d2yyeb1:

Sequence; same for both SEQRES and ATOM records:

>d2yyeb1 d.79.4.1 (B:1-154) Selenide, water dikinase SelD {Aquifex aeolicus [TaxId: 63363]}
mvellklvrssgcaakvgpgdlqeilkgfniytdestlvsigddagvyehngiiwvytvd
iitpvvndpylwgaistanalsdvyamggipvnalaiscfnnceldieifrevirgaldk
lreaktvllgghtiddkepkfglsvagicpegky

Timeline for d2yyeb1:

• d2yyeb1 first appeared in SCOP 1.75
  
• d2yyeb1 appears in SCOPe 2.01
  
• d2yyeb1 appears in SCOPe 2.03
  
• d2yyeb1 appears in the current release, SCOPe 2.08