Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) |
Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins) |
Protein Selenide, water dikinase SelD [160511] (1 species) |
Species Aquifex aeolicus [TaxId:63363] [160512] (3 PDB entries) Uniprot O67139 1-154! Uniprot O67139 28-154 |
Domain d2yyeb1: 2yye B:-6-154 [153833] Other proteins in same PDB: d2yyea2, d2yyeb2 automated match to d2yyea1 complexed with apc, co, po4 |
PDB Entry: 2yye (more details), 2.1 Å
SCOPe Domain Sequences for d2yyeb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yyeb1 d.79.4.1 (B:-6-154) Selenide, water dikinase SelD {Aquifex aeolicus [TaxId: 63363]} ggiegrhmvellklvrssgcaakvgpgdlqeilkgfniytdestlvsigddagvyehngi iwvytvdiitpvvndpylwgaistanalsdvyamggipvnalaiscfnnceldieifrev irgaldklreaktvllgghtiddkepkfglsvagicpegky
Timeline for d2yyeb1: