Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily) 3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold |
Superfamily d.139.1: PurM C-terminal domain-like [56042] (1 family) |
Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins) |
Protein Selenide, water dikinase SelD [160785] (1 species) |
Species Aquifex aeolicus [TaxId:63363] [160786] (3 PDB entries) Uniprot O67139 155-336 |
Domain d2yyea2: 2yye A:155-336 [153832] Other proteins in same PDB: d2yyea1, d2yyeb1 complexed with apc, co, po4 |
PDB Entry: 2yye (more details), 2.1 Å
SCOPe Domain Sequences for d2yyea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yyea2 d.139.1.1 (A:155-336) Selenide, water dikinase SelD {Aquifex aeolicus [TaxId: 63363]} itqsgaqvgqlliltkpigtgilikglkegilkeedineaienmlalndkarnlmlslda tactdvtgfgllghawnicknsnigariffekvpyyqlsenlvkkkiypkgaienlnfvk nylksnldnwklillsdpvtsggllftinkeklekidetakelevnywiigetiaenvle vl
Timeline for d2yyea2: