SCOP 1.75: Domain d2yyea2: 2yye A:155-336

Lineage for d2yyea2 (2yye A:155-336)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (1 family)

5. Family d.139.1.1: PurM C-terminal domain-like [56043] (6 proteins)

6. Protein Selenide, water dikinase SelD [160785] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [160786] (3 PDB entries)
   Uniprot O67139 155-336

8. Domain d2yyea2: 2yye A:155-336 [153832]
   Other proteins in same PDB: d2yyea1, d2yyeb1
   complexed with apc, co, po4

Details for d2yyea2

PDB Entry: 2yye, 2.1 Å

PDB Description: Crystal structure of selenophosphate synthetase from Aquifex aeolicus complexed with AMPCPP

PDB Compounds: (A:) Selenide, water dikinase

SCOP Domain Sequences for d2yyea2:

Sequence; same for both SEQRES and ATOM records:

>d2yyea2 d.139.1.1 (A:155-336) Selenide, water dikinase SelD {Aquifex aeolicus [TaxId: 63363]}
itqsgaqvgqlliltkpigtgilikglkegilkeedineaienmlalndkarnlmlslda
tactdvtgfgllghawnicknsnigariffekvpyyqlsenlvkkkiypkgaienlnfvk
nylksnldnwklillsdpvtsggllftinkeklekidetakelevnywiigetiaenvle
vl

Timeline for d2yyea2:

• d2yyea2 is new in SCOP 1.75
  
• d2yyea2 appears in SCOPe 2.01
  
• d2yyea2 appears in the current release, SCOPe 2.08